PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_D722B6E13.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 444aa    MW: 48631.4 Da    PI: 6.245
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_D722B6E13.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.92.7e-1612511756
                           HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           +lF+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  Traes_6DL_D722B6E13.1 12 RLFKECPHPDEKQRAELSKRLSLDARQVKFWFQNRRTQMK 51
                           68***********************************999 PP

2START125.18.8e-402104011165
                            HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT- CS
                  START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetl 76 
                            ela +a++elvk+a+ ++p+Wv+ s      es+n +e+l + +   +     + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++
  Traes_6DL_D722B6E13.1 210 ELAISAMDELVKMAQTDDPLWVTGSpgfpdkESLNFEEYLHSSQHCIGmkpvgFVSEASRESGLVIIDnSVALVETLMDER-RWSDMF 296
                            57889******************999**99999999***9999666659999***********998651669*********.****** PP

                            S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EES CS
                  START  77 a....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaell 148
                                 ka++le +s+g      gal lm+aelq+lsplvp R++ f+R+++ql ++ w++vdvS+d   ++++       s  ++++l
  Traes_6DL_D722B6E13.1 297 ScmiaKATILEEVSNGiggsrnGALLLMKAELQVLSPLVPiREVIFLRFCKQLAEDAWAVVDVSIDGLLSNQNsaatsAGSNLKCRRL 384
                            ******************************************************************88877776665445679***** PP

                            SEEEEEEEECTCEEEEE CS
                  START 149 pSgiliepksnghskvt 165
                            pSg+++++++ng++kv+
  Traes_6DL_D722B6E13.1 385 PSGCVMQDTPNGYCKVI 401
                            ***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.1E-6857IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-151260IPR009057Homeodomain-like
CDDcd000863.68E-131253No hitNo description
PfamPF000469.8E-141251IPR001356Homeobox domain
SuperFamilySSF466894.6E-131357IPR009057Homeodomain-like
PROSITE profilePS5007114.0741453IPR001356Homeobox domain
PROSITE patternPS0002702851IPR017970Homeobox, conserved site
PROSITE profilePS5084832.837201400IPR002913START domain
SuperFamilySSF559619.2E-21202401No hitNo description
CDDcd088753.49E-81205400No hitNo description
SMARTSM002342.1E-20210443IPR002913START domain
PfamPF018521.6E-32211401IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MGSFVVLSAS CRLFKECPHP DEKQRAELSK RLSLDARQVK FWFQNRRTQM KTQLERHENA  60
LLKQENEKLR TENLTIREAM RTPMCGGCGS PAMLGEVSLE EQHLRIENAR LKDELNRVCT  120
LATKFLGKPV SLLSPLQLQP HLSMPLPNSS LELAVGGIGG IGSMQPSMHG MMSEYAGGAS  180
SSMGTVITPA RATGPALASM VDIDRSVFLE LAISAMDELV KMAQTDDPLW VTGSPGFPDK  240
ESLNFEEYLH SSQHCIGMKP VGFVSEASRE SGLVIIDNSV ALVETLMDER RWSDMFSCMI  300
AKATILEEVS NGIGGSRNGA LLLMKAELQV LSPLVPIREV IFLRFCKQLA EDAWAVVDVS  360
IDGLLSNQNS AATSAGSNLK CRRLPSGCVM QDTPNGYCKV ITNIMITVVC DWNVCTKVTG  420
QSFPGALEVT MLLPLLLHYH CTLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3629190.0AK362919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2011D04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570085.10.0PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLW5GZZ60.0W5GZZ6_WHEAT; Uncharacterized protein
STRINGMLOC_61420.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-138HD-ZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]